PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PSME_00002749-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pseudotsuga
Family ZF-HD
Protein Properties Length: 250aa    MW: 27733.7 Da    PI: 8.6479
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PSME_00002749-RAgenomePRSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer108.63.6e-3453109259
       ZF-HD_dimer   2 ekvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRrevee 59 
                       ++vrY+eC+kNhAas+Ggha+DGCgEfmps g+egt +al+CaAC+CHRnFHRreve 
  PSME_00002749-RA  53 KSVRYRECMKNHAASIGGHAIDGCGEFMPS-GDEGTLEALRCAACNCHRNFHRREVEG 109
                       679**************************9.999*********************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD1257741.0E-2352113IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047704.0E-3155107IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015665.1E-3156107IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152328.38557106IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
SuperFamilySSF466893.5E-19178248IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.609.2E-31181249IPR009057Homeodomain-like
TIGRFAMsTIGR015652.4E-26187243IPR006455Homeodomain, ZF-HD class
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 250 aa     Download sequence    Send to blast
MELGGQEEEI GMPISVSYGP IHESSKLKIL TPGGNGAAAS DEQQQQQQAA AKKSVRYREC  60
MKNHAASIGG HAIDGCGEFM PSGDEGTLEA LRCAACNCHR NFHRREVEGE PPCYYCYNPR  120
KDSRKRPGGS PLPLALPSTS PSGVIARPSP QMIMAFGSGP THENDQQEHD MGFHGIHGAS  180
MAMPIMKKRF RTKFTQEQKD KMCSFADKLG WRIQKHDEAA VQQFCMELGV KRHVLKVWMH  240
NNKHTLGKKM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh7_A1e-261882451875ZF-HD homeobox family protein
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00258DAPTransfer from AT2G02540Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1243410.0BT124341.1 Picea sitchensis clone WS0473_C24 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_001752347.15e-79predicted protein
SwissprotA2Z2597e-66ZHD1_ORYSI; Zinc-finger homeodomain protein 1
SwissprotQ6YXH55e-66ZHD1_ORYSJ; Zinc-finger homeodomain protein 1
TrEMBLD5ADH81e-175D5ADH8_PICSI; Putative uncharacterized protein
STRINGPP1S230_85V6.19e-82(Physcomitrella patens)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G02540.11e-63homeobox protein 21